Vt3.1 precursor, mRNA, complete cds (N01847) Nucleic Acid Card

General Information
Name Vt3.1 precursor, mRNA, complete cds
Organism Conus vitulinus
Organism Diet vermivorous
Organism Clade
Organism Region Indo-Pacific
Notes

Sequence
gtggcttcctagactcctaataaaatcacaattcagggtt
ttacaaacttgaatacaaggcagatgaataaaattctaat
tagaaagcttaaacaagtcagcagggcgcggcggctcaca
cctgtaatcccagcactttggcgttttggagacagacaga
aagagattcgtg
atgttgaaaatgggagtggtgctattca
tctttttggttctgtttcccctggcaacgctccagctgaa
tgcagatcagcctgtagaacgaaatgcagagaacatacag
gacctgaacccagataaaagggtaatcaaaatacctgttc
cgaggagaagggggccttaccgtcggtatggaaattgtta
ctgtccgatcggatga
tttctccagcactttggcgttttg
gagaccaggtgtgttctcacggccacgtttcttgtctaat
gattgagtaaatgatctcagttcacttcagattttttttc
tctgaaacacagctgacaataaacgttggcaaagcaaaaa
aaaaaaaaaaa
Sequence translation MLKMGVVLFIFLVLFPLATLQLNADQPVERNAENIQDLNP
DKRVIKIPVPRRRGPYRRYGNCYCPIG-

References
Wu,X.C., Zhou,M., Peng,C., Shao,X.X. and Chi,C.W. (2010) Novel conopeptides in a form of disulfide-crosslinked dimer. Peptides 31:1001-1006

Internal links
Proteins Encoded Vt3.1 precursor

External links
Ncbi
GenBank GU784862

Tools