Vc6.11 precursor (N01854) Nucleic Acid Card

General Information
Name Vc6.11 precursor
Organism Conus victoriae
Organism Diet molluscivorous
Organism Clade V
Organism Region Indo-Pacific
Notes This sequence displays an error that was not yet corrected. This sequence was retrieved from GenBank and its translation lead to a difference in position 7 of the protein domain compared to the sequence published by Safavi-Hemami (substitution C7R). The authors have been contacted and replied a mistake occur in the nucleic acid sequence submitted to GenBank.

Sequence
atggagaaactgacaattctgcttctggttgctgctgtgc
tgatgtcgacccaggccctaattcaagaacaacgccaaaa
ggcaaagatcaacttgttttcaaagagaaagccatctgct
gagcgttggtggggagagaacgaccgcagagtgtttgggt
cttgtacggcggacgaggaatgttgttttaataattgtgt
tcaagcgtactgcttttttgtttga
Sequence translation MEKLTILLLVAAVLMSTQALIQEQRQKAKINLFSKRKPSA
ERWWGENDRRVFGSCTADEECCFNNCVQAYCFFV-

References
Safavi-Hemami,H., Siero,W.A., Kuang,Z., Williamson,N.A., Karas,J.A., Page,L.R., MacMillan,D., Callaghan,B., Kompella,S.N., Adams,D.J., Norton,R.S., and Purcell,A.W. (2011) Embryonic toxin expression in the cone snail Conus victoriae: primed to kill or divergent function? J. Biol. Chem. 286:22546-22557

Internal links
Proteins Encoded Vc6.11 precursor

External links
Ncbi
GenBank JF433904

Tools