Eb1.3 mRNA, complete cds. (N01866) Nucleic Acid Card

General Information
Name Eb1.3 mRNA, complete cds.
Organism Conus eburneus
Organism Diet piscivorous
Organism Clade
Organism Region
Notes

Sequence
cagctgcggaccagacggacgtgaaacaccatcaccagca
agtggggatagtataagacgcagaacaaggaagcagagag
tctgagaaaataacc
atgggcatgcgtatgatgttcaccg
tgtttctgttggttgtcttggcaactgctgttcttccagt
cactttagatcgtgcatctgatggaaggaatgcagcagcc
aacgccaaaacggctcgcctgatcgcgccattcatcaggg
attattgctgtcctagaggtccctgtatggtatggtgtgg
ttga
agccgctgctgctccaggaccctctgaaccacgaca
tgtcgccctccatctgacctgcatcattttccgtttcttt
gtgccactagaactgaacaactcgatccactagataccca
tgttacctccatattctgcaaatacttggttttgattatc
tttaatttctagttacccttgctggtattacatcgtccaa
aatttaaacaaaaacatgaggggtgtccttacaaacaaaa
tcaggcaatgacaagggaaacaagtcttcgatctagttta
accagttttataatgattaccacaagagcttttgtaccat
ataaaaacaggtgtatgtgtaatgtttcttttgcaaactt
cgctgaaattcttgagagaaaaaa
Sequence translation MGMRMMFTVFLLVVLATAVLPVTLDRASDGRNAAANAKTA
RLIAPFIRDYCCPRGPCMVWCG-

References
Liu,Z., Li,H., Liu,N., Wu,C., Jiang,J., Yue,J. and Dai,Q. (2012) Diversity and evolution of conotoxins in Conus virgo, Conus eburneus, Conus imperialis and Conus marmoreus from the South China Sea. Toxicon 60:982-989

Internal links
Proteins Encoded Eu1.3 precursor

External links
Ncbi
GenBank JF322900

Tools