Vi11.5 mRNA, complete cds. (N01869) Nucleic Acid Card

General Information
Name Vi11.5 mRNA, complete cds.
Organism Conus virgo
Organism Diet vermivorous
Organism Clade XIII
Organism Region Indo-Pacific
Notes

Sequence
atcaacggtga
atgatgtttcgattcacttcagtcagctg
tttcctgctggtcatcgtttgtctgaacttggttgtgctt
accaatgcctgccgccttgaaggatcgtcctgcagacgtt
cttaccagtgctgtcataagagttgctgtattagggagtg
caaatttccgtgtcgatgggttggaaagagggcaacattc
cgagaactcatcctacatcattga
aatgttgcccagaggt
ctgctgcttttcgtcgtaaatggcagataactcaagcctg
acgtttctgcagttctgtctccccgtctacttcttccttc
gtccctctcaccctctcttccttctcctccccacacgata
caaataaatttgatgctgcagaatccaaaaaaaaaaaaaa
aaaaaaaa
Sequence translation MMFRFTSVSCFLLVIVCLNLVVLTNACRLEGSSCRRSYQC
CHKSCCIRECKFPCRWVGKRATFRELILHH-

References
Liu,Z., Li,H., Liu,N., Wu,C., Jiang,J., Yue,J. and Dai,Q. (2012) Diversity and evolution of conotoxins in Conus virgo, Conus eburneus, Conus imperialis and Conus marmoreus from the South China Sea. Toxicon 60:982-989

Internal links
Proteins Encoded Vi11.5 precursor

External links
Ncbi
GenBank JF322904

Tools