contryphan-Vi conotoxin mRNA, complete cds. (N01871) Nucleic Acid Card

General Information
Name contryphan-Vi conotoxin mRNA, complete cds.
Organism Conus virgo
Organism Diet vermivorous
Organism Clade XIII
Organism Region Indo-Pacific
Notes

Sequence
catctacaccctctgtctccctgattgctgcctccagtcg
acccgccctcatcgcagcgcagacttggtaagaagtgaag
accctttatc
atggggaaactgacaatactggttcttgtt
gctgctgtactgttgtcgacccaggtcatggttcaaggtg
acggagatcaacctgcagatcgtaatgcagtacgaagaga
cgataacccaggtggactgagtggaaagttcatgaatgtt
ctacgtcggtctggatgtccatggcatccttggtgtggct
ga
tcggaatccacgattgctatgacagccaacagtgccgc
actcgatttaccctacagtgatctgattgctccaaaacta
tgatgtttcggaaaccgtattcgttgctgcggccattttc
tgttgtgttgtaattaaataaaacgatgacaatctcaaaa
aaaaaaaaaaaaaaaaaaaaaaaaaa
Sequence translation MGKLTILVLVAAVLLSTQVMVQGDGDQPADRNAVRRDDNP
GGLSGKFMNVLRRSGCPWHPWCG-

References
Liu,Z., Li,H., Liu,N., Wu,C., Jiang,J., Yue,J. and Dai,Q. (2012) Diversity and evolution of conotoxins in Conus virgo, Conus eburneus, Conus imperialis and Conus marmoreus from the South China Sea. Toxicon 60:982-989

Internal links
Proteins Encoded Contryphan-Vi precursor

External links
Ncbi
GenBank JF322906

Tools