Vi6.7 mRNA, complete cds. (N01872) Nucleic Acid Card

General Information
Name Vi6.7 mRNA, complete cds.
Organism Conus virgo
Organism Diet vermivorous
Organism Clade XIII
Organism Region Indo-Pacific
Notes

Sequence
atctgagctgacgcagtctgcgtacgttcctctgtctggt
gaagtgagagtcccacagctgtgacaccagcccaaacctt
tcaactcactacgtggcagttgcagttttcagtgtgtgga
caggattgcacaaaattcagg
atgtcaggattgggaatca
tggtgctaacccttctacttcttgtgttcatggtgaccag
tcatcaggatagtggagagaagcgggcgactcaaaggaac
gcaatcaacgtcagacggagaagatcaatcattcggagaa
cagtagatgaggcgtgcaatgagtactgtgaggagcggaa
caagaactgctgcggcagaacagatggagaacccgtatgt
gcacaggcatgcctcggatag
tttctgtgcactgtctcat
tcattcttttatcagtacaagtgtaaacgagacctgtcag
gaagtcgaagggtgctcgtaagttgataagcattgtttac
tgggacgaacggatttgagatgcaaagagaataaaacagc
aacaagtggaaaaaaaaaaaaaaaaaaaaa
Sequence translation MSGLGIMVLTLLLLVFMVTSHQDSGEKRATQRNAINVRRR
RSIIRRTVDEACNEYCEERNKNCCGRTDGEPVCAQACLG-

References
Liu,Z., Li,H., Liu,N., Wu,C., Jiang,J., Yue,J. and Dai,Q. (2012) Diversity and evolution of conotoxins in Conus virgo, Conus eburneus, Conus imperialis and Conus marmoreus from the South China Sea. Toxicon 60:982-989

Internal links
Proteins Encoded Vi6.7 precursor

External links
Ncbi
GenBank JF436965, JF322907

Tools