Im11.7 mRNA, complete cds. (N01874) Nucleic Acid Card

General Information
Name Im11.7 mRNA, complete cds.
Organism Conus imperialis
Organism Diet vermivorous
Organism Clade XVII
Organism Region Indo-Pacific
Notes

Sequence
cagcacaggaggaccctgaacgggaagagtgagatcagag
aggcacagaagtgacagagatcaacggtcaatc
atgtttc
gtgtgacgtcagtcggctttatcctgctggtcatcgttct
tctgaatttggtggtgcttaccgatgcctactaccaccaa
tgtactttgactgaagaaggaaacccgtgcacatatgatt
ggcagtgctgtcacatgatatgctgctataacagttgcac
atttggctgtaaaaggaggaggcgattccgactactcgac
aaacggtaa
cttgccaagaggtctgctgcttttggtcgta
aatggcagataactccagcctgacgtttctgcagttctgt
ccccctcgtcttttcttccttcgcccttctcaccccctct
ccctcctcctccccgcaccacgctaataaatttgatgctg
cagaatccaaaaaaaaaaaaaaaaaaaaaaaaaa
Sequence translation MFRVTSVGFILLVIVLLNLVVLTDAYYHQCTLTEEGNPCT
YDWQCCHMICCYNSCTFGCKRRRRFRLLDKR-

References
Liu,Z., Li,H., Liu,N., Wu,C., Jiang,J., Yue,J. and Dai,Q. (2012) Diversity and evolution of conotoxins in Conus virgo, Conus eburneus, Conus imperialis and Conus marmoreus from the South China Sea. Toxicon 60:982-989

Internal links
Proteins Encoded Im11.7 precursor

External links
Ncbi
GenBank JF322909

Tools