Vi1.7 precursor, mRNA, complete cds. (N01898) Nucleic Acid Card

General Information
Name Vi1.7 precursor, mRNA, complete cds.
Organism Conus virgo
Organism Diet vermivorous
Organism Clade XIII
Organism Region Indo-Pacific
Notes

Sequence
atgggcatgcggatgatgttcaccgtgtttctgttggttg
tcttggcaaccaccgtcgtttctttcacttcagatcgtgc
acctgatggcaggaatgccgcagctaaagcgtttggcctg
atcactccgaccgtcaggaaaggatgttgttccaatcctg
cctgtatgttgaaaaatccaaacctatgttga
Sequence translation MGMRMMFTVFLLVVLATTVVSFTSDRAPDGRNAAAKAFGL
ITPTVRKGCCSNPACMLKNPNLC-

References

Internal links
Proteins Encoded Vi1.7 precursor

External links
Ncbi
GenBank HQ446466

Tools