Bt3.2 mRNA, complete cds. (N01904) Nucleic Acid Card

General Information
Name Bt3.2 mRNA, complete cds.
Organism Conus betulinus
Organism Diet vermivorous
Organism Clade X
Organism Region Indo-Pacific
Notes

Sequence
atgatgtctaaactgggagtcttgttgaccatctgcctgc
ttctgtttccccttactgctcttccgatggatggagatca
acctgtagaccgacctgcagagcgtatgcagggcaacatt
tcatctgaacagcatcccatgtttgatcccatcaaaaggt
gctgcacgcagagctgcacgacatgcttcccttgttgctg
a
Sequence translation MMSKLGVLLTICLLLFPLTALPMDGDQPVDRPAERMQGNI
SSEQHPMFDPIKRCCTQSCTTCFPCC-

References

Internal links
Proteins Encoded Bt3.2 precursor

External links
Ncbi
GenBank HQ857543

Tools