Bt3.4 mRNA, complete cds. (N01906) Nucleic Acid Card

General Information
Name Bt3.4 mRNA, complete cds.
Organism Conus betulinus
Organism Diet vermivorous
Organism Clade X
Organism Region Indo-Pacific
Notes

Sequence
atgatgtctaaactgggagtcttgttgaccatctgcctgc
ttctgtttccccttactgctcttccgatggatggagacca
acctcaggagcgtaaggaggatgaaaagtcagctgcactg
caaccctggtttgatcccgttaaacggtgctgccaggcag
gatgttcgcgatatatgtgcttgccttgttgtcaatga
Sequence translation MMSKLGVLLTICLLLFPLTALPMDGDQPQERKEDEKSAAL
QPWFDPVKRCCQAGCSRYMCLPCCQ-

References

Internal links
Proteins Encoded Bt3.4 precursor

External links
Ncbi
GenBank HQ857545

Tools