Conus tessulatus clone TsMLKM-013 conotoxin scaffold III/IV precursor, mRNA, complete cds (N00191) Nucleic Acid Card

General Information
Name Conus tessulatus clone TsMLKM-013 conotoxin scaffold III/IV precursor, mRNA, complete cds
Organism Conus tessulatus
Organism Diet vermivorous
Organism Clade XVI
Organism Region Indo-Pacific
Notes

Sequence
gaggttcgtg
atgttgaaaatgggagtggtgctattcgtc
tttctggtcctgtttcccctagcaacgcttcagctggatg
cagatcaacctgtagaacgatatgcggagaacaaacagct
cgtcagcccatacgaaaggaggcaaatcataytgcatgct
ctggggcagcgacaatgctgtgattggcaatggtgcgacg
gagcttgtgattgctgcgcg
tagcgccgaacatycatarm
gctgtgctgggcggctttatccaacaacgacagcgtttgt
tgattycatatatcattgcgcccacrcctcttgtnctaar
aatg
Sequence translation MLKMGVVLFVFLVLFPLATLQLDADQPVERYAENKQLVSP
YERRQII?HALGQRQCCDWQWCDGACDCCA

References
Conticello,S.G., Gilad,Y., Avidan,N., Ben-Asher,E., Levy,Z. and Fainzilber,M. (2001) Mechanisms for evolving hypervariability: the case of conopeptides Mol. Biol. Evol. 18:120-131

Internal links
Proteins Encoded Ts3.6 precursor

External links
Ncbi
GenBank AF215091

Tools