Vi1.6 mRNA, complete cds. (N01918) Nucleic Acid Card

General Information
Name Vi1.6 mRNA, complete cds.
Organism Conus virgo
Organism Diet vermivorous
Organism Clade XIII
Organism Region Indo-Pacific
Notes

Sequence
cagctgcggaccagacggacgtggaaaagcatcgcctgca
agtggggatagtaccaggcacacagaacaaggaagcaaag
aatctgagataataacc
atgggcatgcggatgatgttcgt
cgtgtttctgttggttgtcttcgcatcctctgtcacctta
gatcgtgcatcttatggcaggtatgcttcacccgtcgaca
gagcgtctgccctgatcgctcaggccatccttcgagattg
ctgctccaatcctccttgtgcccataataatccagactgt
cgttaa
agacgctgcttgctccaggggcctctgaaccacg
acatgccgccctctgcctgacctgcttcactttccgtctc
tttgtaccactagaactgaacaaaactcgatccactgggc
tcccacgttatctctgtattctcaaactacttggttttga
tagtctttaatttctactcacacttgctgtcattacatcg
tcccaaatttaatcaggaacacgaggggtgtctcttcaat
aaaa
Sequence translation MGMRMMFVVFLLVVFASSVTLDRASYGRYASPVDRASALI
AQAILRDCCSNPPCAHNNPDCR-

References

Internal links
Proteins Encoded Vi1.6 precursor

External links
Ncbi
GenBank JF436964

Tools