contryphan-Vi mRNA, complete cds. (N01919) Nucleic Acid Card

General Information
Name contryphan-Vi mRNA, complete cds.
Organism Conus virgo
Organism Diet vermivorous
Organism Clade XIII
Organism Region Indo-Pacific
Notes

Sequence
cctgattgctgcctccagtcgacccgccctcatcgcagcg
cagacttgaagtgaagatcctttatc
atggggaaactgac
aatactggttcttgttgctgctgtactgttgtcgacccag
gtcatggttcaaggtgacggagatcaacctgcagatcgta
atgcagtacgaagagacgataacccaggtggactgagtgg
aaagttcatgaatgttctacgtcggtctggatgtccatgg
catccttggtgtggctga
tcggaatccacgattgctatga
cagccaacagtgccgcactcgatttaccctacagtgatct
gattgctccaaaactatgatgtttcggaaaccgtattcgt
tgctgcggccattttctgttgtgttgtaattaaataaaac
gatgacaatctcgtttacatcttgattgttatcactgtca
aaaaaaaaaaaaaaaaaaaa
Sequence translation MGKLTILVLVAAVLLSTQVMVQGDGDQPADRNAVRRDDNP
GGLSGKFMNVLRRSGCPWHPWCG-

References

Internal links
Proteins Encoded Contryphan-Vi precursor

External links
Ncbi
GenBank JF460782

Tools