conantokin-E2 mRNA, complete cds. (N01920) Nucleic Acid Card

General Information
Name conantokin-E2 mRNA, complete cds.
Organism Conus eburneus
Organism Diet piscivorous
Organism Clade
Organism Region
Notes

Sequence
ctgcagcacgacgtgtctcctgctctctctcaatctctct
gaccgctgcctggagccgcccagccgtcgtctcaacacag
acttggtacagcttggtacagatccgtg
atgcaatccttc
acctgcatgtgtctgctggttccactcctcctctttttcc
atctgactcaagtatcggacacggcagaccatggaggggc
cgccacggacgtccgctcggctgaccgcaccctgaaacga
tttccccatgacttccgccgggccccgaaacgaagatccg
acggtcactacgataggaaccggaaaacctctgtgcagtt
agacacggaattattggttgagggagttcgcgagggtcaa
gaggagagagctgaagcttcatatgaaaagctgctagaga
taggtcgttga
caggttgaagcagactccatgctgacggc
cgtcggtaccaacgaacacactggactgtggatcgtttcc
atcccttccgtttcctttctcccgatgtttcatgctcatc
ccaaggcttatgcatccagcccgcagtttcttcctaatct
cctgctaaaataaacaaacaaggaaaacaaaaaacttatc
atacataaagcatgtttttaaaagaaatgatttcgattca
tacaaggaaattgaatagaaagataataaattgacggcct
actacaaaaaaaaaaaaaaaaa
Sequence translation MQSFTCMCLLVPLLLFFHLTQVSDTADHGGAATDVRSADR
TLKRFPHDFRRAPKRRSDGHYDRNRKTSVQLDTELLVEGV
REGQEERAEASYEKLLEIGR-

References
Liu,Z., Li,H., Liu,N., Wu,C., Jiang,J., Yue,J. and Dai,Q. (2012) Diversity and evolution of conotoxins in Conus virgo, Conus eburneus, Conus imperialis and Conus marmoreus from the South China Sea. Toxicon 60:982-989

Internal links
Proteins Encoded Conantokin-Eu2 precursor

External links
Ncbi
GenBank JF460783

Tools