Cal12.1p4 precursor, mRNA, partial cds. (N01929) Nucleic Acid Card

General Information
Name Cal12.1p4 precursor, mRNA, partial cds.
Organism Conus californicus
Organism Diet piscivorous
Organism Clade Early
Organism Region Eastern Pacific
Notes

Sequence
gacctcatcaccaatagctacaccagaggaaaacccagac
atgttacttcatggcggaacttgaaaactcgggacgtctg
cgattcgctggtagaaggacgctgtatccacaatggctgt
cagtgtgatcgaagtgcacctcatggtaattgctgcgaca
ctgacggttgtacttcattatggtggtgtcccaagaccaa
atgggactga
Sequence translation DLITNSYTRGKPRHVTSWRNLKTRDVCDSLVEGRCIHNGC
QCDRSAPHGNCCDTDGCTSLWWCPKTKWD-

References

Internal links
Proteins Encoded Cal12.1p4 precursor

External links
Ncbi
GenBank JF724080

Tools