Conus vexillum M superfamily MLKM group conopeptide Vx3-R01 mRNA, complete cds. (N01938) Nucleic Acid Card

General Information
Name Conus vexillum M superfamily MLKM group conopeptide Vx3-R01 mRNA, complete cds.
Organism Conus vexillum
Organism Diet vermivorous
Organism Clade XII
Organism Region Indo-Pacific
Notes

Sequence
atgatgctgaaaatgggagtggtgctattcgtctttctgg
tcctgtttcccccggcaacgctccaactggatgcagatca
acctgtagaacgatatgtggggaacaaacaggacctcaac
ccagatgaaaggaggggattcatatcgcctgctctgcgcc
gacgacgatgctgtacttggcaagagtgcgacggaaattg
tcgttgctgccaacgt
tag
Sequence translation MMLKMGVVLFVFLVLFPPATLQLDADQPVERYVGNKQDLN
PDERRGFISPALRRRRCCTWQECDGNCRCCQR

References

Internal links
Proteins Encoded Vx3-R01 precursor

External links
Ncbi
GenBank JF510549

Tools