Conus capitaneus M superfamily MLKM group conopeptide Cp+Co3-H02 mRNA, complete cds. (N01940) Nucleic Acid Card

General Information
Name Conus capitaneus M superfamily MLKM group conopeptide Cp+Co3-H02 mRNA, complete cds.
Organism Conus capitaneus
Organism Diet vermivorous
Organism Clade XII
Organism Region Indo-Pacific
Notes

Sequence
atgatgctgaaaatgggagtggtgctattcgtctttctgg
tcctgtttcccctggcaacgctccaactggatgcagatca
acctgtagaacgatatgtggggaacaaacaggacctcaac
ccagatgaaaggaggggattcatatcgcctgctctgcgcc
gacgacgatgctgtacttggcaagagtgcgacggaaattg
tcattgctgccaacgt
tag
Sequence translation MMLKMGVVLFVFLVLFPLATLQLDADQPVERYVGNKQDLN
PDERRGFISPALRRRRCCTWQECDGNCHCCQR

References

Internal links
Proteins Encoded Cp3-H02 precursor

External links
Ncbi
GenBank JF510551

Tools