Conus emaciatus M superfamily MLKM group conopeptide Ec3-YDG04 mRNA, complete cds. (N01947) Nucleic Acid Card

General Information
Name Conus emaciatus M superfamily MLKM group conopeptide Ec3-YDG04 mRNA, complete cds.
Organism Conus emaciatus
Organism Diet vermivorous
Organism Clade XIII
Organism Region Indo-Pacific
Notes

Sequence
atgttgaaaatgggagtggtgctattcacctttctggtcc
tgtttcccctggcaacgctccagctggatgcagatcaacc
tgcggcacgatatgcagagaacaaacaggacctcaaccca
aatgaaaggaaggaaatgatgttgtctgctctgaggcagc
gggcatgctgtgatcctgactggtgcgacgcaggttgtta
tgatgggtgctgc
tag
Sequence translation MLKMGVVLFTFLVLFPLATLQLDADQPAARYAENKQDLNP
NERKEMMLSALRQRACCDPDWCDAGCYDGCC

References

Internal links
Proteins Encoded Ec3-YDG04 precursor

External links
Ncbi
GenBank JF510558

Tools