Conus lividus M superfamily MLKM group conopeptide Lv3-Y02 mRNA, complete cds. (N01949) Nucleic Acid Card

General Information
Name Conus lividus M superfamily MLKM group conopeptide Lv3-Y02 mRNA, complete cds.
Organism Conus lividus
Organism Diet vermivorous
Organism Clade VII
Organism Region Indo-Pacific
Notes

Sequence
atgttgaaaatgggagtgatgctattcacctttctggtcc
tgtttcacctggcagcgccccagctggatgcagatcaacc
tgtagcacgatatgcggggaatacaccggacttcaaccca
aatgaaaggatgaaaatgatgttgtctgctctgaggcaga
ggcgatgctgtatttcgccagcgtgccacaaggattgtta
ttgctgtctg
tag
Sequence translation MLKMGVMLFTFLVLFHLAAPQLDADQPVARYAGNTPDFNP
NERMKMMLSALRQRRCCISPACHKDCYCCL

References

Internal links
Proteins Encoded Lv3-Y02 precursor

External links
Ncbi
GenBank JF510560

Tools