Conus varius M superfamily MLKM group conopeptide Vr3-Y02 mRNA, complete cds. (N01957) Nucleic Acid Card

General Information
Name Conus varius M superfamily MLKM group conopeptide Vr3-Y02 mRNA, complete cds.
Organism Conus varius
Organism Diet
Organism Clade
Organism Region
Notes

Sequence
atgttgaaaatgggagtggtgctattcacctttctggtcc
tgtttcccctggcaacgctccagctagatgcagatcaacc
tgtagaacgatatgcagagaacaaacagggcctcaaccca
gatgaaaggatgaaattcatactgcatgctctggggcagc
ggcgatgctgtatttcgccagcgtgcaacgacacttgtta
ttgctgccaggaccgc
taa
Sequence translation MLKMGVVLFTFLVLFPLATLQLDADQPVERYAENKQGLNP
DERMKFILHALGQRRCCISPACNDTCYCCQDR

References

Internal links
Proteins Encoded Vr3-Y02 precursor

External links
Ncbi
GenBank JF510568

Tools