Conus leopardus M superfamily MLKM group conopeptide Lp+Vr+S+Tr+Rt+Cp+Mi3-Y02 mRNA, complete cds. (N01961) Nucleic Acid Card

General Information
Name Conus leopardus M superfamily MLKM group conopeptide Lp+Vr+S+Tr+Rt+Cp+Mi3-Y02 mRNA, complete cds.
Organism Conus leopardus
Organism Diet vermivorous
Organism Clade
Organism Region Indo-Pacific
Notes

Sequence
atgttgaaaatgggagtggtgctattcacctttctgatcc
tgtttcccctggtaacgctccagctggatgcagatcaacg
tgtagaacgatatgcggagaacaaacaggatctgaaccca
gaagaaaggagggaaataaaattgctcgctctgaggcagc
gatgctgtattgggccaaaatgcatggaagaatgttattg
ctgcgtg
tag
Sequence translation MLKMGVVLFTFLILFPLVTLQLDADQRVERYAENKQDLNP
EERREIKLLALRQRCCIGPKCMEECYCCV

References

Internal links
Proteins Encoded Lp3-Y02 precursor

External links
Ncbi
GenBank JF510578

Tools