Conus caracteristicus M superfamily MLKM group conopeptide Ca3-Y01 mRNA, complete cds. (N01965) Nucleic Acid Card

General Information
Name Conus caracteristicus M superfamily MLKM group conopeptide Ca3-Y01 mRNA, complete cds.
Organism Conus caracteristicus
Organism Diet vermivorous
Organism Clade XIV
Organism Region Indo-Pacific
Notes

Sequence
atgttgaaaatgggagtggtgctattcacttttctggtcc
tgtttcccctggcaacattccagctggatgcagatcaacc
tgtagaacgatatgcggagaacaaacaggacctcagccca
gataaaagggtggaattcatattgcatgctctggggcagc
ggttttgctgtgtttttccatggtgcaccggttgttattg
ctgccgt
tag
Sequence translation MLKMGVVLFTFLVLFPLATFQLDADQPVERYAENKQDLSP
DKRVEFILHALGQRFCCVFPWCTGCYCCR

References

Internal links
Proteins Encoded Ca3-Y01 precursor

External links
Ncbi
GenBank JF510582

Tools