Conus vitulinus M superfamily MLKM group conopeptide Vt3-D02 mRNA, complete cds. (N01974) Nucleic Acid Card

General Information
Name Conus vitulinus M superfamily MLKM group conopeptide Vt3-D02 mRNA, complete cds.
Organism Conus vitulinus
Organism Diet vermivorous
Organism Clade
Organism Region Indo-Pacific
Notes

Sequence
atgttgaaactgggaatggtgctattcatctttctggtcc
tgtttcccctggcaacgctccatttggatgcagatcagcc
tgtagaacgaaatgtgaacaaacagggccttaaaccaaat
gaaaggagattcaggttttctgctccgaggaagcgggaat
gctgtgagtgggaatggtgcgacggagcttgtgattgctg
caat
tag
Sequence translation MLKLGMVLFIFLVLFPLATLHLDADQPVERNVNKQGLKPN
ERRFRFSAPRKRECCEWEWCDGACDCCN

References

Internal links
Proteins Encoded Vt3-D02 precursor

External links
Ncbi
GenBank JF510607

Tools