Conus ebraeus M superfamily MLKM group conopeptide Eb3-H01 mRNA, complete cds. (N01987) Nucleic Acid Card

General Information
Name Conus ebraeus M superfamily MLKM group conopeptide Eb3-H01 mRNA, complete cds.
Organism Conus ebraeus
Organism Diet vermivorous
Organism Clade XI
Organism Region Indo-Pacific,Eastern Pacific
Notes

Sequence
atgatgctgaaaatgggagtggtgctattcgtctttctgg
tcctgtttcccctggcaacgctccaactggatgcagatca
acctgtagaacgatatgcggagaacaaacaggacctccac
ccaaatgaaaggacgggattcatattgcctgctatgaggc
gacgatgctgtcgtcttcgacggtgcaaaacgcattgtca
ttgctgcgtctatagaccc
tga
Sequence translation MMLKMGVVLFVFLVLFPLATLQLDADQPVERYAENKQDLH
PNERTGFILPAMRRRCCRLRRCKTHCHCCVYRP

References

Internal links
Proteins Encoded Eb3-H03 precursor

External links
Ncbi
GenBank JF510621

Tools