Conus varius M superfamily MLKM group conopeptide Vr+Vt+Mi+S+Tx+Tr+Rt3-Q01 mRNA, complete cds. (N01994) Nucleic Acid Card

General Information
Name Conus varius M superfamily MLKM group conopeptide Vr+Vt+Mi+S+Tx+Tr+Rt3-Q01 mRNA, complete cds.
Organism Conus varius
Organism Diet
Organism Clade
Organism Region
Notes

Sequence
atgttgaaaatgggagtggtgctattcatctttctggtac
tgtttcccctggcaacgctccagctggatgcagatcaacc
tgtagaacgatatgcggagaacaaacagctcctcaacaca
gatgaaaggagggaaatcatattgtctgctctgaggacgc
gagtatgctgtcctttcggaggctgccacgaactttgtca
atgctgcgagggt
tag
Sequence translation MLKMGVVLFIFLVLFPLATLQLDADQPVERYAENKQLLNT
DERREIILSALRTRVCCPFGGCHELCQCCEG

References

Internal links
Proteins Encoded Vr3-Q01 precursor

External links
Ncbi
GenBank JF510628

Tools