Conus varius M superfamily MLKM group conopeptide Vr3-L01 mRNA, complete cds. (N01999) Nucleic Acid Card

General Information
Name Conus varius M superfamily MLKM group conopeptide Vr3-L01 mRNA, complete cds.
Organism Conus varius
Organism Diet
Organism Clade
Organism Region
Notes

Sequence
atgttgaaaatgggagtggtgctattcatctttctggtac
tgtttcccctggcaacgctccagctggatgcagatcaacc
tgtagaacgatatgcggagaacaaacagctcctcaacaca
gatgaaaggagggaaatcatattgtctgctctgaggaggc
aatgctgtgatagcaattcgtgcgaatacccgaaatgtct
ttgctgcaacggt
tag
Sequence translation MLKMGVVLFIFLVLFPLATLQLDADQPVERYAENKQLLNT
DERREIILSALRRQCCDSNSCEYPKCLCCNG

References

Internal links
Proteins Encoded Vr3-L01 precursor

External links
Ncbi
GenBank JF510634

Tools