Sequence 5 from patent US 5990295 (N00002) Nucleic Acid Card

General Information
Name Sequence 5 from patent US 5990295
Organism Unknown
Organism Diet
Organism Clade
Organism Region
Notes

Sequence
atgaaactgacgtgcatgatgatcgttgctgtgctgttct
tgacagcctggacgctcgtcatggctgatgactccaacaa
tggactggcgaatcattttttgaaatcacgtgacgaaatg
gaggaccccgaagcttctaaattggagaaaagggcgtgca
gcaaaaaatgggaatattgtatagtaccgatccttggatt
cgtatattgctgccctggcttaatctgtggtcctttcgtc
tgcgtt
tgatagtga
Sequence translation MKLTCMMIVAVLFLTAWTLVMADDSNNGLANHFLKSRDEM
EDPEASKLEKRACSKKWEYCIVPILGFVYCCPGLICGPFV
CV

References
Shon,K.-J., Olivera,B.M. and McIntosh,J.Michael. (1999) Conotoxin peptides Patent: US 5990295 23-NOV-1999

Internal links
Proteins Encoded MrVIB precursor

External links
Ncbi
GenBank AR088834

Tools