Conus terebra M superfamily MLKM group conopeptide Tr+Tx3-E02 mRNA, complete cds. (N02012) Nucleic Acid Card

General Information
Name Conus terebra M superfamily MLKM group conopeptide Tr+Tx3-E02 mRNA, complete cds.
Organism Conus terebra
Organism Diet
Organism Clade
Organism Region
Notes

Sequence
atgttgaaaatgggagtggtgctattcatctttctggtac
tgtttcccctggcaacgctccagctggatgcagatcaacc
tgtagaacgatatgcggagaacaaacagctcctcaaccca
gatgaaaagaggggaatcctattgcctgctctgaggaagt
tctgctgtgattcgaattggtgcaacatttcggattgtga
gtgctgctacggt
tag
Sequence translation MLKMGVVLFIFLVLFPLATLQLDADQPVERYAENKQLLNP
DEKRGILLPALRKFCCDSNWCNISDCECCYG

References

Internal links
Proteins Encoded Tr3-E02 precursor

External links
Ncbi
GenBank JF510650

Tools