Conus coronatus M superfamily MLKM group conopeptide Co3-D02 mRNA, complete cds. (N02018) Nucleic Acid Card

General Information
Name Conus coronatus M superfamily MLKM group conopeptide Co3-D02 mRNA, complete cds.
Organism Conus coronatus
Organism Diet vermivorous
Organism Clade XI
Organism Region Indo-Pacific
Notes

Sequence
atgttgaaaatgggagtggtgctattcgtctttctggtcc
tgtttcccatggcaacgctccagctggatgcagatcaacc
tgtagaacgatatgcggagaacaaacaagaccacaacgca
gatgaaaggatgggatatatattgcctgctctaagtcagc
agacctgctgtgtaaggccatggtgcgacggagcttgtga
ttgctgcgtggacccc
taa
Sequence translation MLKMGVVLFVFLVLFPMATLQLDADQPVERYAENKQDHNA
DERMGYILPALSQQTCCVRPWCDGACDCCVDP

References

Internal links
Proteins Encoded Co3-D02 precursor

External links
Ncbi
GenBank JF510656

Tools