Conus coronatus M superfamily MLKM group conopeptide Co3-D01 mRNA, complete cds. (N02021) Nucleic Acid Card

General Information
Name Conus coronatus M superfamily MLKM group conopeptide Co3-D01 mRNA, complete cds.
Organism Conus coronatus
Organism Diet vermivorous
Organism Clade XI
Organism Region Indo-Pacific
Notes

Sequence
atgttgaaaatgggagtggtgctattcgtctttctggtcc
tgtttcccctggcaacgctccagctggatgcagatcaacc
tgtagaacgatatgcggagaacaaacaagacctcaacgca
gatgaaaggatgggatatatattgcctgctctaagtcagc
agacctgctgtgtaaggccatggtgcgacggagcttgtga
ttgctgcgtggactcc
taa
Sequence translation MLKMGVVLFVFLVLFPLATLQLDADQPVERYAENKQDLNA
DERMGYILPALSQQTCCVRPWCDGACDCCVDS

References

Internal links
Proteins Encoded Co3-D01 precursor

External links
Ncbi
GenBank JF510659

Tools