Conus vexillum M superfamily MLKM group conopeptide Vx+S+Bt+Vt3-F01 mRNA, complete cds. (N02026) Nucleic Acid Card

General Information
Name Conus vexillum M superfamily MLKM group conopeptide Vx+S+Bt+Vt3-F01 mRNA, complete cds.
Organism Conus vexillum
Organism Diet vermivorous
Organism Clade XII
Organism Region Indo-Pacific
Notes

Sequence
atgttgaaaatgggagtggtgctattcacctttctggtcc
tgtttcccctggcaacgctccaactggatgcagatcagca
tgtagaacgaaatgcggagaacaaacaggacctcatccca
gataaaaggagggtaatcctactgcgtgctctaaggcagc
ggcgatgctgtcctatggagtggtgcgacggagattgttt
ttgctgcgtt
tag
Sequence translation MLKMGVVLFTFLVLFPLATLQLDADQHVERNAENKQDLIP
DKRRVILLRALRQRRCCPMEWCDGDCFCCV

References

Internal links
Proteins Encoded Vx3-F01 precursor

External links
Ncbi
GenBank JF510664

Tools