Conus miles M superfamily MLKM group conopeptide Mi3-V01 mRNA, complete cds. (N02029) Nucleic Acid Card

General Information
Name Conus miles M superfamily MLKM group conopeptide Mi3-V01 mRNA, complete cds.
Organism Conus miles
Organism Diet vermivorous
Organism Clade XII
Organism Region Indo-Pacific
Notes

Sequence
atgttgaaaatgggagtggtgctattcacctttctggtcc
tgtttcccctggcaactctccagctggatgcagatcaacc
tcgtgcacgatatgcagagaacaaacaggacttcaaccga
aatgaaaggacgaaaatgatattgtctgctgtctcagctt
cgatgggcaggcagaggcgatgctgtttatggccagagtg
tgggggttgtgtttgctgctac
tag
Sequence translation MLKMGVVLFTFLVLFPLATLQLDADQPRARYAENKQDFNR
NERTKMILSAVSASMGRQRRCCLWPECGGCVCCY

References

Internal links
Proteins Encoded Mi3-V01 precursor

External links
Ncbi
GenBank JF510667

Tools