Conus betulinus M superfamily MLKM group conopeptide Bt14-H02 mRNA, complete cds. (N02033) Nucleic Acid Card

General Information
Name Conus betulinus M superfamily MLKM group conopeptide Bt14-H02 mRNA, complete cds.
Organism Conus betulinus
Organism Diet vermivorous
Organism Clade X
Organism Region Indo-Pacific
Notes

Sequence
atgttgaaaatgggagtggtgctattcacctttctggtcc
tgtttcccctggcaacgctccaactggatgcagatcaacc
tgtagaacgacatgcggagaacaaacaggacctcatccca
gatgaaaggaggggaatcctactgcatgctctaaagcagc
gggtatggtgtgactgggaatggtgctacggagattgtca
ttgcttcgat
tag
Sequence translation MLKMGVVLFTFLVLFPLATLQLDADQPVERHAENKQDLIP
DERRGILLHALKQRVWCDWEWCYGDCHCFD

References

Internal links
Proteins Encoded Bt14-H01 precursor

External links
Ncbi
GenBank JF510674

Tools