Conus arenatus clone ArMLCL-0111 conotoxin scaffold IX precursor, mRNA, complete cds (N00204) Nucleic Acid Card

General Information
Name Conus arenatus clone ArMLCL-0111 conotoxin scaffold IX precursor, mRNA, complete cds
Organism Conus arenatus
Organism Diet vermivorous
Organism Clade XIV
Organism Region Indo-Pacific
Notes

Sequence
cggatcttcagtgttcaccaacagctacacctgccaaccg
atcctttctctgcactacgtggcactttgcagtgtgagra
caagaatctgactacacgcaaa
atgctgtgtcttccagtc
ttcatcatccttcttctgttggcttctcctgcagcttcaa
accctctggaaaagagaatccaaaacgatttgattcgtgc
agcccttgaagacgccgatatggaaaacgacccacggtca
ataatcgactccgttaaaacgttttgctgctcaactttta
atcttggtatttgctgtagtaagaaa
taaccaagaggctt
taaagtgtggctgactttggaaacgacacctccaaactgt
acccggatatgagatgaaaaaaacaggctgtttcttctgc
acatactcgtgtgggttgaaacagtcgtcaaatatacgtg
accattcgcattgtcatgttctccgttttatttacagaac
tgcataccaaattagacaaatgtctttgaaattgaactca
ttttctacagagtataggcagtgaccaattgatgatagtt
caattaattctgattatctaaaactgcttcgacatctttt
ttgtgtgctttttgtgacagtttccgtatcgctaggtcgt
ctgcaagtacaacaatattgtcctctttttcttcagtcat
ggccgagaaaactcatcatgtcaatgtaatcattataatt
acctagctttagagtgacttttcttccgtgttgaatgttt
atcctgtatacaaagagtggtcagatcgactaataaacgc
ttgcatggcaatgtcaaaaaaaaaaaaaaaaaa
Sequence translation MLCLPVFIILLLLASPAASNPLEKRIQNDLIRAALEDADM
ENDPRSIIDSVKTFCCSTFNLGICCSKK

References
Conticello,S.G., Gilad,Y., Avidan,N., Ben-Asher,E., Levy,Z. and Fainzilber,M. (2001) Mechanisms for evolving hypervariability: the case of conopeptides Mol. Biol. Evol. 18:120-131

Internal links
Proteins Encoded Ar5.3 precursor

External links
Ncbi
GenBank AF215104

Tools