Conus betulinus M superfamily MLKM group conopeptide Bt3-T01 mRNA, complete cds. (N02047) Nucleic Acid Card

General Information
Name Conus betulinus M superfamily MLKM group conopeptide Bt3-T01 mRNA, complete cds.
Organism Conus betulinus
Organism Diet vermivorous
Organism Clade X
Organism Region Indo-Pacific
Notes

Sequence
atgggagtggtgctattcacctttctggtcctgtttcccc
tggcgacgctccaactggatgcagatcagcctgtagaacg
atatgcggagaacaaacaggaccactacccaggtgaaagc
aggggaatcctaaaatctgctttaaggaagtgctgtacta
tgtcggtatgccagccgccgccagtgtgtacatgctgcgc
t
tag
Sequence translation MGVVLFTFLVLFPLATLQLDADQPVERYAENKQDHYPGES
RGILKSALRKCCTMSVCQPPPVCTCCA

References

Internal links
Proteins Encoded Bt3-T01 precursor

External links
Ncbi
GenBank JF510692

Tools