Conus varius M superfamily MLKM group conopeptide Vr3-NPP01 mRNA, complete cds. (N02055) Nucleic Acid Card

General Information
Name Conus varius M superfamily MLKM group conopeptide Vr3-NPP01 mRNA, complete cds.
Organism Conus varius
Organism Diet
Organism Clade
Organism Region
Notes

Sequence
atgttgaaaatgggagtggtgctattcacctttctggtcc
tgtttcccctggcaacactccagctggatgcagatcaacc
tgtagaacgatatgcggagaacaaacaggacatcaaccca
gatgaaaggaaggcattcataacgcttgctctggggcagg
agggctgctgcccttccgggccgtgccactttgcggcgtg
taatcctccttgctgcaca
tag
Sequence translation MLKMGVVLFTFLVLFPLATLQLDADQPVERYAENKQDINP
DERKAFITLALGQEGCCPSGPCHFAACNPPCCT

References

Internal links
Proteins Encoded Vr3-NPP01 precursor

External links
Ncbi
GenBank JF510711

Tools