Conus quercinus M superfamily MLKM group conopeptide Qc3-YDG01 mRNA, complete cds. (N02067) Nucleic Acid Card

General Information
Name Conus quercinus M superfamily MLKM group conopeptide Qc3-YDG01 mRNA, complete cds.
Organism Conus quercinus
Organism Diet vermivorous
Organism Clade VII
Organism Region Indo-Pacific
Notes

Sequence
atgttgaaaatgggagtggtgctattcgtctttctggtcc
tgtttcccctggcaacgctccagctggatgcagatcaacc
tgtagcacgatatgcggagaacaaacaggacttcaaccca
aatgaaaggatgaaaacgatgttgtctgctctgaggcagc
ggggatgctgtgatcctcagtggtgcgacgcaggttgtta
tgatgggtgctgc
tag
Sequence translation MLKMGVVLFVFLVLFPLATLQLDADQPVARYAENKQDFNP
NERMKTMLSALRQRGCCDPQWCDAGCYDGCC

References

Internal links
Proteins Encoded Qc3-YDG01 precursor

External links
Ncbi
GenBank JF510730

Tools