Conus ebraeus M superfamily MLKM group conopeptide Eb2C13 mRNA, complete cds. (N02073) Nucleic Acid Card

General Information
Name Conus ebraeus M superfamily MLKM group conopeptide Eb2C13 mRNA, complete cds.
Organism Conus ebraeus
Organism Diet vermivorous
Organism Clade XI
Organism Region Indo-Pacific,Eastern Pacific
Notes

Sequence
atgctgaaaatgggagtggtgatgctattcacctttctgg
tcctgtttcccctggcaacgctccagctggatgcagatca
acctgcagaccgagatgcagagaacaaacaggacctcaac
ccagatggagggaggggaatcatattgcctgctctgagat
ctcagcgttcatgtaactggagttctttgtgtgatcctcc
atcggaacgaatgactgcttttacagccaacaatgccgca
ctcgaattaccctacagtggtttggttgctccagaacaa
t
ga
Sequence translation MLKMGVVMLFTFLVLFPLATLQLDADQPADRDAENKQDLN
PDGGRGIILPALRSQRSCNWSSLCDPPSERMTAFTANNAA
LELPYSGLVAPEQ

References

Internal links
Proteins Encoded Eb2C12 precursor

External links
Ncbi
GenBank JF510737

Tools