Conus caracteristicus M superfamily MMSK group conopeptide Ca+G+M3-KPQR01 mRNA, complete cds. (N02084) Nucleic Acid Card

General Information
Name Conus caracteristicus M superfamily MMSK group conopeptide Ca+G+M3-KPQR01 mRNA, complete cds.
Organism Conus caracteristicus
Organism Diet vermivorous
Organism Clade XIV
Organism Region Indo-Pacific
Notes

Sequence
atgatgtctaaactgggagtcttgttgaccatctgtctgc
ttctgtttccccttactgctcttccgatggatggagatga
acctgcaaaccgacctgtcgagcgtatgcaggacaacatt
tcatctgagcagtatcccttgtttgagaagagacgagatt
gttgcactccgccgaagaaatgcaaagaccgacaatgcaa
accccagagatgttgcgctggacga
taa
Sequence translation MMSKLGVLLTICLLLFPLTALPMDGDEPANRPVERMQDNI
SSEQYPLFEKRRDCCTPPKKCKDRQCKPQRCCAGR

References

Internal links
Proteins Encoded Ca3-KPQR01 precursor

External links
Ncbi
GenBank JF510768

Tools