Conus varius M superfamily MMSK group conopeptide Vr3-SP04 mRNA, complete cds. (N02091) Nucleic Acid Card

General Information
Name Conus varius M superfamily MMSK group conopeptide Vr3-SP04 mRNA, complete cds.
Organism Conus varius
Organism Diet
Organism Clade
Organism Region
Notes

Sequence
atgtctaaactgggagccttgtttgtcatctgtctacttc
tgtttccccttactgctgttccgctggatggagatcaacc
tgcagaccaacctgcacagcgtatgcaggacgacatttca
tctgaacatcccctgtttgatgctgtcagagggtgttgcc
atctgttggcatgccgcatgggatgctcgccttgttgttg
g
tga
Sequence translation MSKLGALFVICLLLFPLTAVPLDGDQPADQPAQRMQDDIS
SEHPLFDAVRGCCHLLACRMGCSPCCW

References

Internal links
Proteins Encoded Vr3-SP04 precursor

External links
Ncbi
GenBank JF510785

Tools