Conus ebraeus M superfamily MMSK group conopeptide Eb3-KP02 mRNA, complete cds. (N02102) Nucleic Acid Card

General Information
Name Conus ebraeus M superfamily MMSK group conopeptide Eb3-KP02 mRNA, complete cds.
Organism Conus ebraeus
Organism Diet vermivorous
Organism Clade XI
Organism Region Indo-Pacific,Eastern Pacific
Notes

Sequence
atgtctaaactgggagccttgttgatcatctgtctacttc
tgttttcccttactgctgttccgctggatggagatcaaca
tgcagaccaacctgcacagcgtctgcaggaccgcattcca
actgaagatcatcccttatttgatcccaacaaacggtgtt
gcccgccggtggcatgcaacatgggatgcaagccttgttg
tgga
tga
Sequence translation MSKLGALLIICLLLFSLTAVPLDGDQHADQPAQRLQDRIP
TEDHPLFDPNKRCCPPVACNMGCKPCCG

References

Internal links
Proteins Encoded Eb3-KP02 precursor

External links
Ncbi
GenBank JF510804

Tools