Conus coronatus M superfamily MMSK group conopeptide Co+Ec3-VP02 mRNA, complete cds. (N02106) Nucleic Acid Card

General Information
Name Conus coronatus M superfamily MMSK group conopeptide Co+Ec3-VP02 mRNA, complete cds.
Organism Conus coronatus
Organism Diet vermivorous
Organism Clade XI
Organism Region Indo-Pacific
Notes

Sequence
atgatgtccaaactgggagtcttgttgaccatctgtctgc
ttctgtttccaattactgccgatccgctggttgaagatca
acctgcagaccgacctgcagatcgtatgcaggacattgca
actgaacagcatcccttgtttgatcctgtcaaacggtgtt
gcgatcggccatgcggcataggatgcgtcccttgttgctt
gcct
taa
Sequence translation MMSKLGVLLTICLLLFPITADPLVEDQPADRPADRMQDIA
TEQHPLFDPVKRCCDRPCGIGCVPCCLP

References

Internal links
Proteins Encoded Co3-VP02 precursor

External links
Ncbi
GenBank JF510814

Tools