Conus emaciatus M superfamily MMSK group conopeptide Ec3-GMAR01 mRNA, complete cds. (N02110) Nucleic Acid Card

General Information
Name Conus emaciatus M superfamily MMSK group conopeptide Ec3-GMAR01 mRNA, complete cds.
Organism Conus emaciatus
Organism Diet vermivorous
Organism Clade XIII
Organism Region Indo-Pacific
Notes

Sequence
atgatgtctaaactgggagtcttgttgaccatctgtgtgc
ttctgtttccccttactgctgttccgctggatggagatca
acctgcagaccaacctgcagagcgtacgcagaacgagcag
catcccttgtttgaccagaaaagagggtgttgccggtggc
catgccccagtatatgcggcatggctaggtgttgctcgtc
a
tga
Sequence translation MMSKLGVLLTICVLLFPLTAVPLDGDQPADQPAERTQNEQ
HPLFDQKRGCCRWPCPSICGMARCCSS

References

Internal links
Proteins Encoded Ec3-GMAR01 precursor

External links
Ncbi
GenBank JF510821

Tools