Conus betulinus M superfamily MMSK group conopeptide Bt+Vt+Tr+Cp3-IP01 mRNA, complete cds. (N02111) Nucleic Acid Card

General Information
Name Conus betulinus M superfamily MMSK group conopeptide Bt+Vt+Tr+Cp3-IP01 mRNA, complete cds.
Organism Conus betulinus
Organism Diet vermivorous
Organism Clade X
Organism Region Indo-Pacific
Notes

Sequence
atgatgtttaaactgggagtcttgttgaccatctatatgc
ttctgtttccctttactgctcttccgctggatggagatca
acctgcagaccaacctctagagcgcatgcagtatgacatg
ttacgtgcagtgaatccctggtttgatcccgtcaaaaggt
gctgctcgaggaactgcgcagtatgcatcccttgttgccc
gaattggccagct
tga
Sequence translation MMFKLGVLLTIYMLLFPFTALPLDGDQPADQPLERMQYDM
LRAVNPWFDPVKRCCSRNCAVCIPCCPNWPA

References

Internal links
Proteins Encoded Bt3.6 precursor

External links
Ncbi
GenBank JF510822

Tools