Conus ebraeus M superfamily MMSK group conopeptide Eb3-KP06 mRNA, complete cds. (N02113) Nucleic Acid Card

General Information
Name Conus ebraeus M superfamily MMSK group conopeptide Eb3-KP06 mRNA, complete cds.
Organism Conus ebraeus
Organism Diet vermivorous
Organism Clade XI
Organism Region Indo-Pacific,Eastern Pacific
Notes

Sequence
atgatgtctaaactgggagtcttgttgactatctgtctac
ttctgtttccccatactgctgttccgctcgatggagatca
acatgcagaccgacctgcagagcgtctgcaggacgacatt
tcatctgaacatcatcccatgtttgatgccgtcaaacgga
gagagcagaaccagttcaagtccttcacttcagtcaaact
tctggactctcgaggagaaaggtgttgcggcccgacggca
tgcttggcgggttgcaagccttgttgtgga
tga
Sequence translation MMSKLGVLLTICLLLFPHTAVPLDGDQHADRPAERLQDDI
SSEHHPMFDAVKRREQNQFKSFTSVKLLDSRGERCCGPTA
CLAGCKPCCG

References

Internal links
Proteins Encoded Eb3-KP04 precursor

External links
Ncbi
GenBank JF510827

Tools