Conus vitulinus M superfamily MMSK group conopeptide Vt+Tx3-TP09 mRNA, complete cds. (N02114) Nucleic Acid Card

General Information
Name Conus vitulinus M superfamily MMSK group conopeptide Vt+Tx3-TP09 mRNA, complete cds.
Organism Conus vitulinus
Organism Diet vermivorous
Organism Clade
Organism Region Indo-Pacific
Notes

Sequence
atgatgtttaaactgggagtcttgttgacaatctgtctcc
ttctgttttcccttaatgctgttccgctggatggagatca
acctgcagaccaacctgcagagcgtctgccggacgacatt
tcatctgaaaataatcccttttatgatcccgtcaaacggt
gttgcatgacttgcttcggttgcacaccttgttgtgga
tg
a
Sequence translation MMFKLGVLLTICLLLFSLNAVPLDGDQPADQPAERLPDDI
SSENNPFYDPVKRCCMTCFGCTPCCG

References

Internal links
Proteins Encoded Vt3-TP09 precursor

External links
Ncbi
GenBank JF510828

Tools