Conus rattus M superfamily MMSK group conopeptide Rt+Tx+Vr+S3-KP06 mRNA, complete cds. (N02118) Nucleic Acid Card

General Information
Name Conus rattus M superfamily MMSK group conopeptide Rt+Tx+Vr+S3-KP06 mRNA, complete cds.
Organism Conus rattus
Organism Diet vermivorous
Organism Clade
Organism Region Indo-Pacific
Notes

Sequence
atgatgtctaaactgggagccttgttgatcatctgtctac
ttctgttttcccttactgctgttccgctggatggagatca
acatgcagaccaacctgcacagcgtctgcaggaccgcatt
ccaactgaagatcatcccttatttgatcccaacaaacggt
gttgcccgccggtggcatgcaacatgggatgcaagccttg
ttgtgga
tga
Sequence translation MMSKLGALLIICLLLFSLTAVPLDGDQHADQPAQRLQDRI
PTEDHPLFDPNKRCCPPVACNMGCKPCCG

References

Internal links
Proteins Encoded Rt3-KP06 precursor

External links
Ncbi
GenBank JF510846

Tools