Conus coronatus M superfamily MMSK group conopeptide Co3-TP01 mRNA, complete cds. (N02121) Nucleic Acid Card

General Information
Name Conus coronatus M superfamily MMSK group conopeptide Co3-TP01 mRNA, complete cds.
Organism Conus coronatus
Organism Diet vermivorous
Organism Clade XI
Organism Region Indo-Pacific
Notes

Sequence
atgatgtttaaactgggagtctttttgaccatctgtctcc
ttccgttttcccttaatgctgttccgttggatggagatca
acctgcagaccaacctgcagagcgtctgctggacgacatt
tcatttgaaaataatcccttttatgatcccgccaaacggt
gttgcaggacttgcttcggttgcacaccttgttgtgga
tg
a
Sequence translation MMFKLGVFLTICLLPFSLNAVPLDGDQPADQPAERLLDDI
SFENNPFYDPAKRCCRTCFGCTPCCG

References

Internal links
Proteins Encoded Co3-TP01 precursor

External links
Ncbi
GenBank JF510853

Tools