Conus varius M superfamily MMSK group conopeptide Vr+Mi+Rt+Co+Ec+Ca3-IP01 mRNA, complete cds. (N02122) Nucleic Acid Card

General Information
Name Conus varius M superfamily MMSK group conopeptide Vr+Mi+Rt+Co+Ec+Ca3-IP01 mRNA, complete cds.
Organism Conus varius
Organism Diet
Organism Clade
Organism Region
Notes

Sequence
atgatgtctaaactgggagtcttgttgaccatctgtctgc
ttctgtttccaattactggtcttccgctggatgaagatca
acatgctgatctacctgcattgcgtgcgcaggcctttgaa
cctgaacatagtccctggtttgatcccgtcagacggtgct
gctcgcaagattgctgggagtgcatcccttgttgcccaaa
c
tga
Sequence translation MMSKLGVLLTICLLLFPITGLPLDEDQHADLPALRAQAFE
PEHSPWFDPVRRCCSQDCWECIPCCPN

References

Internal links
Proteins Encoded Vr3-IP01 precursor

External links
Ncbi
GenBank JF510855

Tools