Conus lividus M superfamily MMSK group conopeptide Lv3-IP01 mRNA, complete cds. (N02129) Nucleic Acid Card

General Information
Name Conus lividus M superfamily MMSK group conopeptide Lv3-IP01 mRNA, complete cds.
Organism Conus lividus
Organism Diet vermivorous
Organism Clade VII
Organism Region Indo-Pacific
Notes

Sequence
atgatgtctaaattgggagtgttgttgaccatctgtctgc
ttctgtttccccttactgctgttcagctggatggagatca
acctgtcgacctacctgcattgcgtacgcaggactttgca
cctgaacatagtccctggtttgaccccgtcaaacggtgct
gttcgcgggactgctgggtatgcatcccttgttgcccgaa
tggatcagct
tga
Sequence translation MMSKLGVLLTICLLLFPLTAVQLDGDQPVDLPALRTQDFA
PEHSPWFDPVKRCCSRDCWVCIPCCPNGSA

References

Internal links
Proteins Encoded Lv3-IP01 precursor

External links
Ncbi
GenBank JF510873

Tools